Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

LL-37 RKS trifluoroacetate salt
H-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH trifluoroacetate salt

H-7882

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7882.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 245.00
CHF 227.85 (7%)
H-7882.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 415.00
CHF 385.95 (7%)
Add to Wish List
Add to Compare

Details

The antimicrobially active LL-37 fragments RK-31 and KR-20 (H-7876) have been identified as physiological components of human sweat.
Item Number 4064380
One Letter Code RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Synonyms LL-37 (7-37), Cationic Antimicrobial Protein 18 (140-170) (human), hCAP-18 (140-170)
Molecular Formula C₁₆₉H₂₉₂N₅₄O₄₅
Relative Molecular Mass 3800.51
CAS Registry Number [672345-61-8] net
Source Synthetic
Storage Conditions -20 ± 5 °C