Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

(Lys²²)-Amyloid β-Protein (1-42) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Lys-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH trifluoroacetate salt

H-7848

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7848.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 295.00
CHF 274.35 (7%)
H-7848.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 495.00
CHF 460.35 (7%)
Add to Wish List
Add to Compare

Details

The Italian mutation (E22K) aggregates more rapidly than the wild-type sequence.
Item Number 4064438
One Letter Code DAEFRHDSGYEVHHQKLVFFAKVGSNKGAIIGLMVGGVVIA
Synonyms Amyloid β-Protein (1-42) Italian Mutation, Amyloid β-Protein (1-42) E22K, Amyloid-beta Peptide (1-42), E22K, Human, Amyloid-beta Protein (1-42) (human), Italian Mutation, [Lys22] - beta - Amyloid (1 - 42), [Lys22]-Abeta (1-42), Human
Molecular Formula C₂₀₂H₃₀₉N₅₅O₆₀S
Relative Molecular Mass 4500.08
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease