Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

(Gln²²)-Amyloid β-Protein (1-42) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH trifluoroacetate salt

H-7844

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7844.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 315.00
CHF 292.95 (7%)
H-7844.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 575.00
CHF 534.75 (7%)
Add to Wish List
Add to Compare

Details

The Dutch mutation (E22Q) aggregates more readily than the wild-type sequence. The resulting fibrils show increased neurotoxicity.
Item Number 4050945
One Letter Code DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA
Synonyms Amyloid β-Protein (1-42) Dutch Mutation, Amyloid β-Protein (1-42) E22Q, Amyloid-beta Peptide(1-42), E22Q, (human), Amyloid-beta Protein (1-42) (human), Dutch Mutation, [Gln22] - beta - Amyloid (1 - 42), [Gln22]-Abeta (1-42), (human)
Molecular Formula C₂₀₃H₃₁₂N₅₆O₅₉S
Relative Molecular Mass 4513.12
CAS Registry Number [147335-12-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease