Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Tau Peptide (337-368) (Repeat 4 Domain) trifluoroacetate salt
H-Val-Glu-Val-Lys-Ser-Glu-Lys-Leu-Asp-Phe-Lys-Asp-Arg-Val-Gln-Ser-Lys-Ile-Gly-Ser-Leu-Asp-Asn-Ile-Thr-His-Val-Pro-Gly-Gly-Gly-Asn-OH trifluoroacetate salt

H-7816

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7816.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 70.00
CHF 65.10 (7%)
H-7816.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 120.00
CHF 111.60 (7%)
Add to Wish List
Add to Compare
Item Number 4099613
One Letter Code VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
Molecular Formula C₁₅₀H₂₄₈N₄₄O₅₀
Relative Molecular Mass 3467.89
CAS Registry Number [330456-27-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Tau Peptides