Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Tau Peptide (306-336) (Repeat 3 Domain) trifluoroacetate salt
H-Val-Gln-Ile-Val-Tyr-Lys-Pro-Val-Asp-Leu-Ser-Lys-Val-Thr-Ser-Lys-Cys-Gly-Ser-Leu-Gly-Asn-Ile-His-His-Lys-Pro-Gly-Gly-Gly-Gln-OH trifluoroacetate salt

H-7814

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7814.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 70.00
CHF 65.10 (7%)
H-7814.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 120.00
CHF 111.60 (7%)
Add to Wish List
Add to Compare

Details

The amphipathic helical structure of the third fragment (306-336) in the four-repeat microtubule-binding domain of the water-soluble tau protein could be responsible for the formation of the neuropathological filament.
Item Number 4095430
One Letter Code VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
Molecular Formula C₁₄₃H₂₃₆N₄₂O₄₂S
Relative Molecular Mass 3247.77
CAS Registry Number [330456-26-3] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Tau Peptides