Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

BNP-32 (human) hydrochloride salt
H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH hydrochloride salt
(Disulfide bond)

H-7774

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7774.0500 0.5 mg Ships within 3-5 business days  
CHF 120.00
CHF 111.60 (7%)
H-7774.1000 1 mg Ships within 3-5 business days  
CHF 205.00
CHF 190.65 (7%)
Add to Wish List
Add to Compare
Item Number 4095916
APC Number 14-1-90
One Letter Code SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Synonyms Brain Natriuretic Peptide-32 (human), Nesiritide, BNP (1-32), human
Molecular Formula C₁₄₃H₂₄₄N₅₀O₄₂S₄
Relative Molecular Mass 3464.09
CAS Registry Number [124584-08-3] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Biomarker for cardiac diseases; Lipolysis-inducing peptide