Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

C-Type Natriuretic Peptide (1-53) (human) acetate salt
H-Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-OH acetate salt
(Disulfide bond)

H-7766

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7766.0500 0.5 mg Ships within 3-5 business days  
CHF 225.00
CHF 209.25 (7%)
H-7766.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 395.00
CHF 367.35 (7%)
Add to Wish List
Add to Compare
Item Number 4095913
APC Number 14-1-42
One Letter Code DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC
Synonyms CNP-53 (human), C-Type Natriuretic Peptide (1-53), human
Molecular Formula C₂₅₁H₄₁₇N₈₁O₇₁S₃
Relative Molecular Mass 5801.77
CAS Registry Number [141294-77-1] net
Source Synthetic
Storage Conditions -20 ± 5 °C