Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Galanin (human) acetate salt
H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-OH acetate salt

H-7762

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7762.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 100.00
CHF 93.00 (7%)
H-7762.1000 1 mg Request lead time  
CHF 175.00
CHF 162.75 (7%)
Add to Wish List
Add to Compare

Details

Galanin has been shown to inhibit acetylcholine release, glutamate release and carbachol-stimulated phosphatidylinositol hydrolysis in the hippocampus. The peptide hormone is also linked to behavioral and cognitive deficits in Alzheimer's disease.
Item Number 4095896
APC Number 46-1-01
One Letter Code GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Synonyms Galanin, human
Molecular Formula C₁₃₉H₂₁₀N₄₂O₄₃
Relative Molecular Mass 3157.45
CAS Registry Number [119418-04-1] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease