Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

GLP-2 (1-33) (human) ammonium acetate salt
H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH ammonium acetate salt

H-7742

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7742.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 100.00
CHF 93.00 (7%)
H-7742.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 175.00
CHF 162.75 (7%)
Add to Wish List
Add to Compare
Item Number 4095874
APC Number 46-0-80
One Letter Code HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Synonyms Glucagon-Like Peptide 2 (human), Preproglucagon (146-178) (human), Proglucagon (126-158) (human), GLP-2, human
Molecular Formula C₁₆₅H₂₅₄N₄₄O₅₅S
Relative Molecular Mass 3766.16
CAS Registry Number [223460-79-5] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Diabetes