Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

pTH (1-34) (human) trifluoroacetate salt
H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH trifluoroacetate salt

H-7736

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7736.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 90.00
CHF 83.70 (7%)
H-7736.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 150.00
CHF 139.50 (7%)
Add to Wish List
Add to Compare

Details

Intermittent administration of teriparatide stimulates bone formation by increasing the number of osteoblasts. Agonist of the parathyroid hormone receptor PTH1.
Item Number 4095855
APC Number 22-1-25
One Letter Code SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Synonyms Teriparatide, Parathyroid Hormone (1-34), human (Teriparatide)
Molecular Formula C₁₈₁H₂₉₁N₅₅O₅₁S₂
Relative Molecular Mass 4117.77
CAS Registry Number [52232-67-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C