Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Amyloid β-Protein (40-1) hydrochloride salt
H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH hydrochloride salt

H-7728

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7728.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 80.00
CHF 74.40 (7%)
Add to Wish List
Add to Compare

Details

Inactive control
Item Number 4095853
APC Number 62-0-77
One Letter Code VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Synonyms β-Amyloid (40-1)
Molecular Formula C₁₉₄H₂₉₅N₅₃O₅₈S
Relative Molecular Mass 4329.86
CAS Registry Number [144409-99-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease