Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

(Des-Glu²²)-Amyloid β-Protein (1-42) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH trifluoroacetate salt

H-7686

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7686.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 285.00
CHF 265.05 (7%)
Add to Wish List
Add to Compare

Details

The Osaka (E22delta) mutation of Amyloid β promotes β-sheet transformation, radical production, and synaptotoxicity, but not neurotoxicity.
Item Number 4074277
APC Number 62-1-06
One Letter Code DAEFRHDSGYEVHHQKLVFFADVGSNKGAIIGLMVGGVVIA
Synonyms Amyloid β-Protein (1-42) Japanese Mutation, Amyloid β-Protein (1-42) E22Δ, E22delta, Osaka Mutation, [Des Glu22] Amyloid Beta (1-42)
Molecular Formula C₁₉₈H₃₀₄N₅₄O₅₇S
Relative Molecular Mass 4384.99
CAS Registry Number [1239313-74-6] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease