Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Amyloid β-Protein (3-40) trifluoroacetate salt
H-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

H-7672

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7672.0500 0.5 mg Ships within 3-5 business days  
CHF 130.00
CHF 120.90 (7%)
H-7672.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 235.00
CHF 218.55 (7%)
Add to Wish List
Add to Compare
Item Number 4046796
APC Number 62-0-99
One Letter Code EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Synonyms β-Amyloid (3-40)
Molecular Formula C₁₈₇H₂₈₅N₅₁O₅₄S
Relative Molecular Mass 4143.70
CAS Registry Number [157884-70-3] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease