Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Amyloid β-Protein (11-42) trifluoroacetate salt
H-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH trifluoroacetate salt

H-7668

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7668.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 105.00
CHF 97.65 (7%)
H-7668.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 190.00
CHF 176.70 (7%)
Add to Wish List
Add to Compare
Item Number 4073393
APC Number 62-0-97
One Letter Code EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Synonyms β Amyloid (11-42)
Molecular Formula C₁₅₂H₂₄₄N₄₀O₄₂S
Relative Molecular Mass 3335.92
CAS Registry Number [157802-70-5] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease