Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

(Arg¹³)-Amyloid β-Protein (1-40) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

H-7662

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7662.0500 0.5 mg Ships within 3-5 business days  
CHF 160.00
CHF 148.80 (7%)
H-7662.1000 1 mg Ships within 3-5 business days  
CHF 265.00
CHF 246.45 (7%)
Add to Wish List
Add to Compare

Details

H13R, a mutation in the metal-binding region of Abeta reduces its copper-mediated toxicity. The native rodent sequence containing an arginine at this position is more tolerant to metals than the human amyloid peptide.
Item Number 4095736
APC Number 62-0-27
One Letter Code DAEFRHDSGYEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Synonyms [Arg13] β-Amyloid (1-40)
Molecular Formula C₁₉₄H₃₀₀N₅₄O₅₈S
Relative Molecular Mass 4348.91
CAS Registry Number [1816939-33-9] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease