Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

(Pro³)-Gastric Inhibitory Polypeptide (human) trifluoroacetate salt
H-Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH trifluoroacetate salt

H-7584

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7584.0500 0.5 mg Ships within 3-5 business days  
CHF 100.00
CHF 93.00 (7%)
H-7584.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 170.00
CHF 158.10 (7%)
Add to Wish List
Add to Compare

Details

GIP antagonist.
Item Number 4062141
APC Number 46-1-34
One Letter Code YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Synonyms (Pro³)-GIP (human), (Pro³)-Glucose-Dependent Insulinotropic Polypeptide (human), (Pro3) Gastric Inhibitory Peptide (GIP), human
Molecular Formula C₂₂₆H₃₃₈N₆₀O₆₄S
Relative Molecular Mass 4951.60
CAS Registry Number [299898-52-5] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords GIP mimetic
Areas of Interest Diabetes