Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Des-Lys³⁸)-M65 trifluoroacetate salt
H-Cys-Asp-Ala-Thr-Cys-Gln-Phe-Arg-Lys-Ala-Ile-Asp-Asp-Cys-Gln-Lys-Gln-Ala-His-His-Ser-Asn-Val-Pro-Gly-Asn-Ser-Val-Phe-Lys-Glu-Cys-Met-Lys-Gln-Lys-Lys-Glu-Phe-Lys-Ala-NH₂ trifluoroacetate salt
(Disulfide bonds between Cys¹ and Cys⁵/Cys¹⁴ and Cys³²)

H-7538

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7538.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 350.00
CHF 325.50 (7%)
H-7538.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 650.00
CHF 604.50 (7%)
Add to Wish List
Add to Compare
Item Number 4094738
One Letter Code CDATCQFRKAIDDCQKQAHHSNVPGNSVFKECMKQKKEFKA-NH₂
Synonyms (Des-Lys³⁸)-PAC1 Receptor Antagonist M65
Molecular Formula C₁₉₉H₃₁₄N₆₂O₆₀S₅
Relative Molecular Mass 4695.39
CAS Registry Number [1816939-38-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C