Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

(Glu¹⁷·²¹·²⁴)-Osteocalcin (1-49) (human) trifluoroacetate salt
H-Tyr-Leu-Tyr-Gln-Trp-Leu-Gly-Ala-Pro-Val-Pro-Tyr-Pro-Asp-Pro-Leu-Glu-Pro-Arg-Arg-Glu-Val-Cys-Glu-Leu-Asn-Pro-Asp-Cys-Asp-Glu-Leu-Ala-Asp-His-Ile-Gly-Phe-Gln-Glu-Ala-Tyr-Arg-Arg-Phe-Tyr-Gly-Pro-Val-OH trifluoroacetate salt
(Disulfide bond)

H-7534

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7534.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 95.00
CHF 88.35 (7%)
H-7534.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 360.00
CHF 334.80 (7%)
H-7534.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 605.00
CHF 562.65 (7%)
Add to Wish List
Add to Compare

Details

The peptide hormone osteocalcin is involved not only in bone formation, it also plays an important role in glucose metabolism and could regulate testosteron. In mice, only the completely decarboxylated form of the peptide shows the latter hormonal activities, whereas in humans, osteocalcin, partially decarboxylated osteocalcins, and the uncarboxylated peptide seem to be involved. Generally, obese individuals have been shown to have lower osteocalcin(s) levels than non-obese controls, and type 2 diabetic individuals have lower plasma osteocalcin than non-diabetic individuals.
Item Number 4063516
One Letter Code YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Synonyms Osteocalcin (1-49) (human) (decarboxylated)
Molecular Formula C₂₆₆H₃₈₁N₆₇O₇₆S₂
Relative Molecular Mass 5797.49
CAS Registry Number [1927927-11-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Bone hormone involved in glucose metabolism
Areas of Interest Diabetes
Obesity Research