Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

RVG-9R trifluoroacetate salt
H-Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly-Gly-Gly-Gly-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt

H-7502

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7502.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 290.00
CHF 269.70 (7%)
H-7502.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 495.00
CHF 460.35 (7%)
Add to Wish List
Add to Compare

Details

Chimeric rabies virus glycoprotein fragment peptide (RVG-9R peptide) was able to bind and transduce siRNA to neuronal cells in vitro, resulting in efficient gene silencing. Repeated administration of RVG-9R-bound siRNA did not induce inflammatory cytokines nor anti-peptide antibodies.
Item Number 4058134
One Letter Code YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
Synonyms Rabies Virus Glycoprotein (194-221) Nonaarginine Chimer, Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)
Molecular Formula C₂₀₁H₃₃₄N₈₂O₅₅S₂
Relative Molecular Mass 4843.51
CAS Registry Number [1678417-57-6] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Cell-permeable Peptides