Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Met(O)³⁵)-Amyloid β-Protein (1-40) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met(O)-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

H-7476

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7476.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 265.00
CHF 246.45 (7%)
H-7476.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 440.00
CHF 409.20 (7%)
Add to Wish List
Add to Compare

Details

Oxidation of Met35 attenuates the formation of Aβ40 oligomers.
Item Number 4018327
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGFAMSNKGAIIGLM(O)VGGVV
Synonyms Amyloid β-Protein (1-40) sulfoxide
Molecular Formula C₁₉₄H₂₉₅N₅₃O₅₉S
Relative Molecular Mass 4345.86
CAS Registry Number [178302-50-6] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease