Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Des-Glu²²)-Amyloid β-Protein (1-40) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

H-7474

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7474.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 205.00
CHF 190.65 (7%)
H-7474.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 350.00
CHF 325.50 (7%)
Add to Wish List
Add to Compare

Details

The Osaka mutation was the first deletion-type mutation to be identified in APP and Aβ.
The Aβ E22delta mutant is more resistant to degradation by two major Aβ-degrading enzymes, neprilysin and insulin-degrading enzyme. Synthetic mutant Aβ showed unusual aggregation properties with enhanced oligomerization but no fibrillization. It also inhibited hippocampal long-term potentiation more efficiently than wild-type Aβ. A transgenic mouse model containing APP with the E693delta mutation has been developed. APP(OSK)-Tg mice exhibit intraneuronal Aβ E22delta oligomers and memory impairment as early as eight months of age.
Item Number 4091431
One Letter Code DAEFRHDSGYEVHHQKLVFFADVGSNKGAIIGLMVGGVV
Synonyms Amyloid β-Protein (1-40) Osaka or Japanese Mutation, Amyloid β-Protein (1-40) E22Δ
Molecular Formula C₁₈₉H₂₈₈N₅₂O₅₅S
Relative Molecular Mass 4200.75
CAS Registry Number [1678416-36-8] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease