Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Amyloid β-Protein (2-42) trifluoroacetate salt
H-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH trifluoroacetate salt

H-7472

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7472.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 405.00
CHF 376.65 (7%)
Add to Wish List
Add to Compare

Details

Aβ 2-42 could be a biomarker for differentiating AD from other degenerative dementias, such as frontotemporal dementias (FTD). The peptide promotes phagocytosis by macrophages.
Item Number 4036028
One Letter Code AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Formula C₁₉₉H₃₀₆N₅₄O₅₇S
Relative Molecular Mass 4399.01
CAS Registry Number [1678416-22-2] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease