Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Amyloid β-Protein (1-39) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-OH trifluoroacetate salt

H-7458

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7458.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 220.00
CHF 204.60 (7%)
H-7458.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 400.00
CHF 372.00 (7%)
Add to Wish List
Add to Compare

Details

Small quantities of Aβ37, 38 and 39 can be detected in CSF together with Aβ40, the most abundant Aβ homolog, Aβ42, and N-terminally truncated amyloid peptides. The relative amounts depend on the variant of Alzheimer's disease. The C-terminally truncated amyloid peptides are also found in amyloid plaques.
Item Number 4073896
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
Molecular Formula C₁₈₉H₂₈₆N₅₂O₅₇S
Relative Molecular Mass 4230.73
CAS Registry Number [115427-62-8] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease