Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Biotinyl-εAhx-Amyloid β-Protein (1-40) trifluoroacetate salt
Biotinyl-εAhx-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

H-7456

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7456.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 145.00
CHF 134.85 (7%)
H-7456.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 535.00
CHF 497.55 (7%)
Add to Wish List
Add to Compare

Details

The flexible LC spacer increases the accessibility of the biotin moiety.
Item Number 4090156
One Letter Code Biotinyl-εAhx- DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Synonyms Biotinyl-LC-Amyloid β-Protein (1-40), Biotinyl-εAhx-Aβ40
Molecular Formula C₂₁₀H₃₂₀N₅₆O₆₁S₂
Relative Molecular Mass 4669.32
CAS Registry Number [1802086-72-1] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Biotin