Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

5-TAMRA-Amyloid β-Protein (1-40) trifluoroacetate salt
5-TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

H-7452

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7452.0100 0.1 mg Ships within 3-5 business days  
CHF 232.00
CHF 215.76 (7%)
H-7452.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 873.00
CHF 811.89 (7%)
Add to Wish List
Add to Compare

Details

Anderson and Webb could verify using transmission electron microscopy that N-terminal labeling of Aβ40 with TAMRA and other fluorescent dyes does not prevent the formation of protofibrils and amyloid fibrils of various widths.
Item Number 4090154
One Letter Code TAMRA- DAEFRHDSGYEVHHQKLVFFAEDVGFAMSNKGAIIGLMVGGVV
Synonyms 5-TAMRA-Aβ40
Molecular Formula C₂₁₉H₃₁₅N₅₅O₆₂S
Relative Molecular Mass 4742.31
CAS Registry Number [1802087-81-5] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease