Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Galanin (mouse, rat)
H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH₂

H-7450

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7450.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 258.00
CHF 239.94 (7%)
H-7450.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 464.00
CHF 431.52 (7%)
Add to Wish List
Add to Compare

Details

The isolation and characterization of cDNAs encoding rat galanin and its precursor peptide reveal that rat galanin is synthesized initially as part of a 124-amino acid precursor that includes a signal peptide, galanin, and a 60-amino acid galanin mRNA-associated peptide.
The neuropeptide galanin shows multiple inhibitory actions on neurotransmission and memory. In Alzheimer's disease, increased galanin-containing fibers hyperinnervate cholinergic neurons within the basal forebrain in association with a decline in cognition.
Item Number 4030645
APC Number 46-5-10
One Letter Code GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH₂
Molecular Formula C₁₄₁H₂₁₁N₄₃O₄₁
Relative Molecular Mass 3164.49
CAS Registry Number [114547-31-8]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease