Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

5-FAM-Amyloid β-Protein (1-40) trifluoroacetate salt
Fluorescein-5-carbonyl-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

H-7446

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7446.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 150.00
CHF 139.50 (7%)
H-7446.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 595.00
CHF 553.35 (7%)
Add to Wish List
Add to Compare
Item Number 4090152
One Letter Code Fluorescein-5-carbonyl- DAEFRHDSGYEVHHQKLVFFAEDVGFAMSNKGAIIGLMVGGVV
Synonyms 5-FAM-Aβ40
Molecular Formula C₂₁₅H₃₀₅N₅₃O₆₄S
Relative Molecular Mass 4688.17
CAS Registry Number [1678416-08-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease