Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Amyloid β-Protein (1-40) (HFIP-treated)
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (HFIP-treated)

H-7438

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7438.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 110.00
CHF 102.30 (7%)
H-7438.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 295.00
CHF 274.35 (7%)
H-7438.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 550.00
CHF 511.50 (7%)
Add to Wish List
Add to Compare

Details

H-7438 was obtained by dissolving Amyloid β-Protein (1-40) (H-1194) in HFIP, aliquoting, and removing the solvent as described in the literature. The morphology of the resulting peptide was studied by transmission electron microscopy (TEM). The magenta arrow points to the nucleation centers where aggregation starts. The yellow arrow indicates the fibrils which are formed as long thin helical structures with regular twists.
Item Number 4090147
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Synonyms Aβ40 (HFIP-treated)
Molecular Formula C₁₉₄H₂₉₅N₅₃O₅₈S
Relative Molecular Mass 4329.86
CAS Registry Number [131438-79-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease