Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Amyloid β-Protein (5-42) ammonium salt
H-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH ammonium salt

H-7436

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7436.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 170.00
CHF 158.10 (7%)
H-7436.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 595.00
CHF 553.35 (7%)
Add to Wish List
Add to Compare

Details

Abeta 5-42 is produced from amyloid precursor protein by action of caspases. It is deposited in Alzheimer's disease brain as well, but less prone to aggregation.
Item Number 4041241
One Letter Code RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Synonyms Aβ (5-42)
Molecular Formula C₁₈₂H₂₈₅N₅₁O₅₂S
Relative Molecular Mass 4051.64
CAS Registry Number [1678415-97-8]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease