Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Amyloid β-Protein (4-42) ammonium salt
H-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH ammonium salt

H-7434

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7434.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 495.00
CHF 460.35 (7%)
Add to Wish List
Add to Compare

Details

Aβ 4-42 could be one of the earliest and most prominent Aβ species deposited in AD brain. Sequencing of amyloid plaque cores showed that 64% of the isolated Aβ had a phenylalanine at its N-terminus, and indeed, IP/MS experiments identified Aβ 4-42 as a major Aβ species in AD patients. Additionally, Aβ 4-42 was found to be a component of cotton wool plaques in familial AD patients with the V261I PS1 mutation. Aβ 4-42 was discovered as well in amyloid deposits from vascular dementia and familial Danish dementia patients. These observations indicate that Aβ 4-42 may contribute to the development of multiple CNS diseases.
Item Number 4090138
One Letter Code FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Synonyms Aβ (4-42)
Molecular Formula C₁₉₁H₂₉₄N₅₂O₅₃S
Relative Molecular Mass 4198.82
CAS Registry Number [157884-72-5] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease