Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page
New!

Availability: In stock

Amyloid β-Protein (3-42) ammonium salt
H-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH ammonium salt

H-7432

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7432.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 495.00
CHF 460.35 (7%)
Add to Wish List
Add to Compare

Details

The N-terminally truncated Aβ42 may be formed in increased amounts as AD progresses. Aβ 3-42 is the precursor of the Pyr-peptide. (Pyr³)-Aβ 3-42 positive plaques are resistant to age-dependent degradation likely due to their high stability and propensity to aggregate.
Item Number 4090137
One Letter Code EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Synonyms Aβ (3-42)
Molecular Formula C₁₉₆H₃₀₁N₅₃O₅₆S
Relative Molecular Mass 4327.94
CAS Registry Number [157884-74-7] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease