Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Cys²⁶)-Amyloid β-Protein (1-40) (Dimer) trifluoroacetate salt
(H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Cys-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH)₂ trifluoroacetate salt
(Disulfide bond)

H-7418

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7418.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 309.00
CHF 287.37 (7%)
H-7418.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 515.00
CHF 478.95 (7%)
Add to Wish List
Add to Compare

Details

Dimer of H-7402.
Item Number 4089807
One Letter Code (DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV)₂
Synonyms Amyloid β-Protein (1-40) S26C (Dimer)
Molecular Formula C₃₈₈H₅₈₈N₁₀₆O₁₁₄S₄
Relative Molecular Mass 8689.85
CAS Registry Number [1802087-75-7] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease