Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Val³⁴)-Amyloid β-Protein (1-40) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Val-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

H-7414

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7414.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 270.00
CHF 251.10 (7%)
H-7414.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 465.00
CHF 432.45 (7%)
Add to Wish List
Add to Compare

Details

Cerebral amyloid angiopathy (CAA) is a common finding in Alzheimer’s disease in which amyloid-Aβ vascular deposits are featured in >80% of the cases. Mutations in the positions 21-23 (e.g. Dutch mutation E22Q) are primarily associated with CAA, although they manifest with strikingly different clinical phenotypes: cerebral hemorrhage or dementia. The Piedmont L34V Aβ mutant, located outside this hot spot, shows a similar hemorrhagic phenotype, albeit less aggressive than the widely studied Dutch variant.
Item Number 4089805
One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGVMVGGVV
Synonyms Amyloid β-Protein (1-40) L34V, Amyloid β-Protein (1-40) Piedmont Mutation
Molecular Formula C₁₉₃H₂₉₃N₅₃O₅₈S
Relative Molecular Mass 4315.84
CAS Registry Number [1678415-83-2] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease