Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Gln²²,Asn²³)-Amyloid β-Protein (1-40) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asn-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

H-7412

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7412.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 290.00
CHF 269.70 (7%)
H-7412.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 490.00
CHF 455.70 (7%)
Add to Wish List
Add to Compare

Details

Transgenic mice expressing the vasculotropic Dutch/Iowa (E693Q/D694N) mutant human Aβ precursor protein in brain (Tg-SwDI) accumulate abundant cerebral microvascular fibrillar amyloid deposits and exhibit robust neuroinflammation. In vitro, the doubly mutated Aβ peptides showed an increased propensity to fibrillation and pathogenicity compared to the Dutch and Iowa single mutants.
Item Number 4089804
One Letter Code DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV
Synonyms Amyloid β-Protein (1-40) E22Q/D23N, Amyloid β-Protein (1-40) Dutch/Iowa Double Mutation
Molecular Formula C₁₉₄H₂₉₇N₅₅O₅₆S
Relative Molecular Mass 4327.90
CAS Registry Number [374796-75-5] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease