Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Amyloid β-Protein (1-40) (scrambled) trifluoroacetate salt
H-Ala-Glu-Gly-Asp-Ser-His-Val-Leu-Lys-Glu-Gly-Ala-Tyr-Met-Glu-Ile-Phe-Asp-Val-Gln-Gly-His-Val-Phe-Gly-Gly-Lys-Ile-Phe-Arg-Val-Val-Asp-Leu-Gly-Ser-His-Asn-Val-Ala-OH trifluoroacetate salt

H-7408

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7408.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 260.00
CHF 241.80 (7%)
H-7408.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 490.00
CHF 455.70 (7%)
Add to Wish List
Add to Compare

Details

Inactive control for H-1194 and H-5568.
Item Number 4089803
APC Number 62-1-07
One Letter Code AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Synonyms β-Amyloid (1-40) Scrambled
Molecular Formula C₁₉₄H₂₉₅N₅₃O₅₈S
Relative Molecular Mass 4329.87
CAS Registry Number [1678415-68-3] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease