Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Amyloid β-Protein (1-42) (scrambled) trifluoroacetate salt
H-Ala-Ile-Ala-Glu-Gly-Asp-Ser-His-Val-Leu-Lys-Glu-Gly-Ala-Tyr-Met-Glu-Ile-Phe-Asp-Val-Gln-Gly-His-Val-Phe-Gly-Gly-Lys-Ile-Phe-Arg-Val-Val-Asp-Leu-Gly-Ser-His-Asn-Val-Ala-OH trifluoroacetate salt

H-7406

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7406.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 349.00
CHF 324.57 (7%)
H-7406.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 475.00
CHF 441.75 (7%)
Add to Wish List
Add to Compare

Details

Inactive control for H-1368, H-6466, H-8146
Item Number 4064853
APC Number 62-0-46
One Letter Code AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Synonyms β-Amyloid (1-42) Scrambled
Molecular Formula C₂₀₃H₃₁₁N₅₅O₆₀S
Relative Molecular Mass 4514.10
CAS Registry Number [1678415-52-5] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease