Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Prokineticin 2 Isoform 2 (human) trifluoroacetate salt
H-Ala-Val-Ile-Thr-Gly-Ala-Cys-Asp-Lys-Asp-Ser-Gln-Cys-Gly-Gly-Gly-Met-Cys-Cys-Ala-Val-Ser-Ile-Trp-Val-Lys-Ser-Ile-Arg-Ile-Cys-Thr-Pro-Met-Gly-Lys-Leu-Gly-Asp-Ser-Cys-His-Pro-Leu-Thr-Arg-Lys-Val-Pro-Phe-Phe-Gly-Arg-Arg-Met-His-His-Thr-Cys-Pro-Cys-Leu-Pro-Gly-Leu-Ala-Cys-Leu-Arg-Thr-Ser-Phe-Asn-Arg-Phe-Ile-Cys-Leu-Ala-Gln-Lys-OH trifluoroacetate salt
(Disulfide bonds, air oxidized)

H-7342

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7342.0100 0.1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 250.00
CHF 232.50 (7%)
H-7342.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1'000.00
CHF 930.00 (7%)
H-7342.1000 1 mg Request lead time  
CHF 1'700.00
CHF 1'581.00 (7%)
Add to Wish List
Add to Compare

Details

Prokineticin 2 (Bv8) is one of the first neuropeptides that appears to directly convey circadian rhythm signaling to other CNS structures and, therefore, it may be a critical output molecule regulating biological rhythms. The peptide has the capacity to strongly suppress nocturnal locomotor activity. Prokineticin 2 transmits the behavioural circadian rhythm of the suprachiasmatic nucleus.
The peptide binds to the G-protein-coupled receptor PKR2. Gardiner et al. showed that prokineticin 2 potently inhibits food intake.
Item Number 4074529
One Letter Code AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK
Synonyms Bv8
Molecular Formula C₃₇₉H₆₀₆N₁₁₄O₁₀₁S₁₃
Relative Molecular Mass 8792.55
CAS Registry Number [423206-00-2] net
Source Synthetic
Storage Conditions -20 ± 5 °C