Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Arg⁶)-Amyloid β-Protein (1-40) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-Arg-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

H-7336

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7336.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 155.00
CHF 144.15 (7%)
H-7336.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 257.00
CHF 239.01 (7%)
Add to Wish List
Add to Compare

Details

The English (H6R) mutation of β-amyloid peptides accelerates fibrillation without increasing protofibril formation. Ono et al. showed that the English and Tottori mutations alter Abeta assembly at its earliest stages, monomer folding and oligomerization, and produce oligomers that are more toxic to cultured neuronal cells than are wild type oligomers.
The exchange of His⁶ by Arg influences the structure of the Cu(II) complex formed by Aβ peptides.
Item Number 4075964
One Letter Code DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Synonyms Amyloid β-Protein (1-40) English Mutation, Amyloid β-Protein (1-40) H6R
Molecular Formula C₁₉₄H₃₀₀N₅₄O₅₈S
Relative Molecular Mass 4348.91
CAS Registry Number [1802084-26-9] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease