Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Asn⁷)-Amyloid β-Protein (1-40) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asn-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

H-7334

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7334.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 149.00
CHF 138.57 (7%)
H-7334.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 249.00
CHF 231.57 (7%)
Add to Wish List
Add to Compare

Details

The Tottori (D7N) mutation of β-amyloid peptides accelerates fibrillation without increasing protofibril formation. Ono et al. showed that the English and Tottori mutations alter Abeta assembly at its earliest stages, monomer folding and oligomerization, and produce oligomers that are more toxic to cultured neuronal cells than are wild type oligomers.
Item Number 4075963
One Letter Code DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Synonyms Amyloid β-Protein (1-40) Tottori Mutation, Amyloid β-Protein (1-40) D7N
Molecular Formula C₁₉₄H₂₉₆N₅₄O₅₇S
Relative Molecular Mass 4328.88
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease