Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Asn²³)-Amyloid β-Protein (1-40)
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asn-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH

H-7332

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7332.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 151.00
CHF 140.43 (7%)
H-7332.1000 1 mg Ships within 3-5 business days  
CHF 251.00
CHF 233.43 (7%)
Add to Wish List
Add to Compare

Details

The Iowa (D23N) mutant of Aβ 40 considerably more rapidly assembles in solution to form fibrils than the WT Aβ sequence. These fibrils also show a different structure, which could be responsible for their increased toxicity.
Item Number 4039929
One Letter Code DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV
Synonyms Amyloid β-Protein (1-40) Iowa Mutation, Amyloid β-Protein (1-40) D23N, Abeta (1-40) D23N
Molecular Formula C₁₉₄H₂₉₆N₅₄O₅₇S
Relative Molecular Mass 4328.88
CAS Registry Number [374796-72-2]
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease