Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

LL-37 trifluoroacetate salt
H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH trifluoroacetate salt

H-7298

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7298.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 246.00
CHF 228.78 (7%)
H-7298.0005 5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 738.00
CHF 686.34 (7%)
Add to Wish List
Add to Compare

Details

LL-37 is an antimicrobial peptide with angiogenic activity. It corresponds to the C-terminal sequence (134-170) of the human cathelicidin antimicrobial protein hCAP18/LL-37 and is extracellularly released from hCAP18/LL-37 by proteolytic processing. hCAP18/LL-37 is an effector of the innate immune system and is expressed in leukocytes and epithelial cells where it is upregulated in association with inflammation and injury. An overexpression of hCAP18/LL-37 in a series of breast carcinomas could be demonstrated. LL-37 has been suggested to stimulate epithelial cell proliferation partially through formyl peptide receptor-like 1 (FPRL1) since blocking the receptor with pertussis toxin decreased the proliferative effect of LL-37 by approximately 50 %.
Item Number 4042456
APC Number 87-9-66
One Letter Code [LL-37, 37 aa]
Synonyms Antibacterial Protein LL-37 (human), LL37, CAMP
Molecular Formula C₂₀₅H₃₄₀N₆₀O₅₃
Relative Molecular Mass 4493.33
CAS Registry Number [154947-66-7] net
Source Synthetic
Storage Conditions -20 ± 5 °C