Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

rec IGF-II (1-67) (human)
H-Ala-Tyr-Arg-Pro-Ser-Glu-Thr-Leu-Cys-Gly-Gly-Glu-Leu-Val-Asp-Thr-Leu-Gln-Phe-Val-Cys-Gly-Asp-Arg-Gly-Phe-Tyr-Phe-Ser-Arg-Pro-Ala-Ser-Arg-Val-Ser-Arg-Arg-Ser-Arg-Gly-Ile-Val-Glu-Glu-Cys-Cys-Phe-Arg-Ser-Cys-Asp-Leu-Ala-Leu-Leu-Glu-Thr-Tyr-Cys-Ala-Thr-Pro-Ala-Lys-Ser-Glu-OH

H-7020

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-7020.0010 10 µg Ships within 3-5 business days  
CHF 113.00
CHF 105.09 (7%)
H-7020.0050 50 µg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 299.00
CHF 278.07 (7%)
Add to Wish List
Add to Compare

Details

approx. ED₅₀ = 0.1 ng/mL
IGF-II seems to be specifically involved in fetal growth, but otherwise shows similar biological activities to IGF-I.
Item Number 4030639
One Letter Code AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Molecular Formula C₃₂₁H₄₉₉N₉₃O₁₀₁S₆
Relative Molecular Mass 7469.46
CAS Registry Number [96081-16-2]
Source Recombinant
Storage Conditions -20 ± 5 °C
Keywords Recombinant protein
Areas of Interest Cell Culture
Diabetes