Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

pTH (2-34) (human) acetate salt
H-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH acetate salt

H-6786

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6786.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 140.00
CHF 130.20 (7%)
H-6786.1000 1 mg Ships within 3-5 business days  
CHF 210.00
CHF 195.30 (7%)
H-6786.5000 5 mg Ships within 3-5 business days  
CHF 840.00
CHF 781.20 (7%)
Add to Wish List
Add to Compare

Details

Impurity of teriparatide produced during the chemical synthesis and a potential metabolite. The N-terminally truncated sequence showed a reduced potency in stimulating bone formation.
Like pTH (1-34), pTH (2-34) decreased coronary perfusion pressure in isolated rat hearts but in contrast to pTH (1-34) it had no effect on heart rate.
Item Number 4069253
One Letter Code VSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Molecular Formula C₁₇₈H₂₈₆N₅₄O₄₉S₂
Relative Molecular Mass 4030.70
CAS Registry Number [247902-18-7] net
Source Synthetic
Storage Conditions -20 ± 5 °C