Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Galanin Message Associated Peptide (1-41) amide trifluoroacetate salt
H-Glu-Leu-Glu-Pro-Glu-Asp-Glu-Ala-Arg-Pro-Gly-Gly-Phe-Asp-Arg-Leu-Gln-Ser-Glu-Asp-Lys-Ala-Ile-Arg-Thr-Ile-Met-Glu-Phe-Leu-Ala-Phe-Leu-His-Leu-Lys-Glu-Ala-Gly-Ala-Leu-NH₂ trifluoroacetate salt

H-6780

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6780.0500 0.5 mg Ships within 3-5 business days  
CHF 361.00
CHF 335.73 (7%)
H-6780.1000 1 mg Ships within 3-5 business days  
CHF 670.00
CHF 623.10 (7%)
Add to Wish List
Add to Compare
Item Number 4029327
APC Number 41-1-20
One Letter Code ELEPEDEARPGGFDRLQSEDKAIRTIMEFLAFLHLKEAGAL-NH₂
Synonyms GMAP (1-41) amide, Preprogalanin (65-105) amide
Molecular Formula C₂₀₆H₃₂₆N₅₆O₆₄S
Relative Molecular Mass 4643.26
CAS Registry Number [132699-74-2] net
Source Synthetic
Storage Conditions -20 ± 5 °C