Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

β-CGRP (human)
H-Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH₂
(Disulfide bond)

H-6730

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6730.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 309.00
CHF 287.37 (7%)
H-6730.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 464.00
CHF 431.52 (7%)
Add to Wish List
Add to Compare
Item Number 4015500
APC Number 22-1-14
One Letter Code ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH₂
Synonyms CGRP-II (human), Calcitonin Gene Related Peptide II, human
Molecular Formula C₁₆₂H₂₆₇N₅₁O₄₈S₃
Relative Molecular Mass 3793.41
CAS Registry Number [101462-82-2]
Source Synthetic
Storage Conditions -20 ± 5 °C