Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Lys²²)-Amyloid β-Protein (1-40) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Lys-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

H-6698

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6698.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 155.00
CHF 144.15 (7%)
H-6698.1000 1 mg Ships within 3-5 business days  
CHF 257.00
CHF 239.01 (7%)
Add to Wish List
Add to Compare

Details

The Italian mutation of β-amyloid 1-40 (E22K) aggregates more rapidly than the wild-type sequence 1-40. It showed increased neurotoxicity, which (according to a solid-phase NMR-study of Masuda et al.) may be due to the salt bridge formed between Lys²² and Asp²³ in the minor conformer. As the Arctic, Flemish, and Dutch mutants, the Italian mutant is degraded considerably more slowly than wild-type Aβ by neprilysin.
Item Number 4049003
APC Number 62-0-91
One Letter Code DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Synonyms Amyloid β-Protein (1-40) Italian Mutation, Amyloid β-Protein (1-40) E22K, [Lys22] β-Amyloid (1-40)
Molecular Formula C₁₉₅H₃₀₀N₅₄O₅₆S
Relative Molecular Mass 4328.92
CAS Registry Number [302905-01-7] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease