Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

(Gln²²)-Amyloid β-Protein (1-40) trifluoroacetate salt
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH trifluoroacetate salt

H-6696

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6696.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 155.00
CHF 144.15 (7%)
H-6696.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 257.00
CHF 239.01 (7%)
Add to Wish List
Add to Compare

Details

The Dutch mutation (E22Q) of amyloid β-peptide aggregates more readily than the wild-type peptide and the resulting fibrils show increased neurotoxicity. The mutant peptide E22Q induced apoptosis of cerebral endothelial cells at a concentration of 25 μm, whereas WT Aβ 1-40 and the Italian mutant E22K (H-6698) showed no effect.
Item Number 4039928
APC Number 62-0-89
One Letter Code DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV
Synonyms Amyloid β-Protein (1-40) Dutch Mutation, Amyloid β-Protein (1-40) E22Q, [Gln22] β-Amyloid (1-40)
Molecular Formula C₁₉₄H₂₉₆N₅₄O₅₇S
Relative Molecular Mass 4328.88
CAS Registry Number [144410-00-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Alzheimer's Disease