Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Toxin GaTx1 trifluoroacetate salt
H-Cys-Gly-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Glu-Gln-Lys-Cys-Ala-Glu-Cys-Cys-Gly-Gly-Ile-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Asn-Arg-NH₂ trifluoroacetate salt
(Disulfide bonds between Cys¹ and Cys¹⁸/Cys⁴ and Cys²⁵/Cys¹⁵ and Cys³⁰/Cys¹⁹ and Cys³²)

H-6678

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6678.0100 0.1 mg Ships within 3-5 business days  
CHF 250.00
CHF 232.50 (7%)
H-6678.0500 0.5 mg Ships within 3-5 business days  
CHF 1'000.00
CHF 930.00 (7%)
H-6678.1000 1 mg Ships within 3-5 business days  
CHF 1'700.00
CHF 1'581.00 (7%)
Add to Wish List
Add to Compare

Details

GaTx1 is a component of the venom of the yellow scorpion (Leiurus quinquestriatus hebraeus). The highly bridged 34-peptide, a chloride channel ligand, potently and reversibly inhibits cystic fibrosis transmembrane conductance regulator (CFTR) chloride channels when the channels are in the interburst closed state. Since the toxin inhibits CFTR only when applied to the cytoplasmic side, it is unlikely that CFTR represents the native target.
Manufactured and sold under license from Georgia Tech Research Corporation, USA; patent WO/2007/137163 (PCT/US2007/069243).
Item Number 4063634
One Letter Code CGPCFTTDHQMEQKCAECCGGIGKCYGPQCLCNR-NH₂
Molecular Formula C₁₄₇H₂₂₄N₄₆O₄₇S₉
Relative Molecular Mass 3676.27
CAS Registry Number [1926163-15-6] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Ion Channel Modulating Agents