Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Lepirudin acetate salt
H-Leu-Thr-Tyr-Thr-Asp-Cys-Thr-Glu-Ser-Gly-Gln-Asn-Leu-Cys-Leu-Cys-Glu-Gly-Ser-Asn-Val-Cys-Gly-Gln-Gly-Asn-Lys-Cys-Ile-Leu-Gly-Ser-Asp-Gly-Glu-Lys-Asn-Gln-Cys-Val-Thr-Gly-Glu-Gly-Thr-Pro-Lys-Pro-Gln-Ser-His-Asn-Asp-Gly-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-Leu-Gln-OH acetate salt
(Disulfide bonds, random oxidized)

H-6618

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6618.0001 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 1'545.00
CHF 1'436.85 (7%)
H-6618.0005 5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 6'180.00
CHF 5'747.40 (7%)
Add to Wish List
Add to Compare

Details

Synthetic peptide. Lepirudin is an anticoagulant which functions as a direct thrombin inhibitor.
Item Number 4048773
One Letter Code LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ
Synonyms (Leu¹,Thr²)-Hirudin (desulfated)
Molecular Formula C₂₈₇H₄₄₀N₈₀O₁₁₁S₆
Relative Molecular Mass 6979.52
CAS Registry Number [138068-37-8] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Keywords Thrombin inhibitor

H-6618

Enzyme Substrates Inhibitors
Thrombin (Coagulation Factor IIa)