Shopping Cart - CHF 0.00

You have no items in your shopping cart.

Return to Previous Page

Availability: In stock

Gastric Inhibitory Polypeptide (3-42) (human) trifluoroacetate salt
H-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH trifluoroacetate salt

H-6614

Product No. Pack Size Available ADS InfoAnalytical Data Sheet Unit Price Online Order Price Qty
H-6614.0500 0.5 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 294.00
CHF 273.42 (7%)
H-6614.1000 1 mg Ships within 1 business day ADSExemplary Data Sheet of a current available lot.
CHF 525.00
CHF 488.25 (7%)
Add to Wish List
Add to Compare

Details

Gastric inhibitory polypeptide (3-42) represents the major physiological degradation product of gastric inhibitory polypeptide (GIP). It is generated by proteolytic processing of GIP by dipeptidyl peptidase IV (DPP IV).
Item Number 4034653
One Letter Code EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Synonyms GIP (3-42) (human), Glucose-Dependent Insulinotropic Polypeptide (3-42) (human)
Molecular Formula C₂₁₄H₃₂₄N₅₈O₆₃S
Relative Molecular Mass 4749.35
CAS Registry Number [1802086-25-4] net
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Diabetes